summaryrefslogtreecommitdiffstats
path: root/drivers/scsi
Commit message (Collapse)AuthorAgeFilesLines
...
| * | [SCSI] scsi_dh_rdac: Fix error pathRichard Weinberger2012-01-101-0/+2
| | | | | | | | | | | | | | | | | | | | | | | | If create_singlethread_workqueue() failes, rdac_init should fail too. Signed-off-by: Richard Weinberger <richard@nod.at> Acked-by: "Moger, Babu" <Babu.Moger@netapp.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
* | | Merge branch 'for-3.3/core' of git://git.kernel.dk/linux-blockLinus Torvalds2012-01-151-1/+1
|\ \ \ | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | * 'for-3.3/core' of git://git.kernel.dk/linux-block: (37 commits) Revert "block: recursive merge requests" block: Stop using macro stubs for the bio data integrity calls blockdev: convert some macros to static inlines fs: remove unneeded plug in mpage_readpages() block: Add BLKROTATIONAL ioctl block: Introduce blk_set_stacking_limits function block: remove WARN_ON_ONCE() in exit_io_context() block: an exiting task should be allowed to create io_context block: ioc_cgroup_changed() needs to be exported block: recursive merge requests block, cfq: fix empty queue crash caused by request merge block, cfq: move icq creation and rq->elv.icq association to block core block, cfq: restructure io_cq creation path for io_context interface cleanup block, cfq: move io_cq exit/release to blk-ioc.c block, cfq: move icq cache management to block core block, cfq: move io_cq lookup to blk-ioc.c block, cfq: move cfqd->icq_list to request_queue and add request->elv.icq block, cfq: reorganize cfq_io_context into generic and cfq specific parts block: remove elevator_queue->ops block: reorder elevator switch sequence ... Fix up conflicts in: - block/blk-cgroup.c Switch from can_attach_task to can_attach - block/cfq-iosched.c conflict with now removed cic index changes (we now use q->id instead)
| * | | block: misc updates to blk_get_queue()Tejun Heo2011-12-141-1/+1
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | * blk_get_queue() is peculiar in that it returns 0 on success and 1 on failure instead of 0 / -errno or boolean. Update it such that it returns %true on success and %false on failure. * Make sure the caller checks for the return value. * Separate out __blk_get_queue() which doesn't check whether @q is dead and put it in blk.h. This will be used later. This patch doesn't introduce any functional changes. Signed-off-by: Tejun Heo <tj@kernel.org> Signed-off-by: Jens Axboe <axboe@kernel.dk>
* | | | Merge branch 'for-linus' of git://selinuxproject.org/~jmorris/linux-securityLinus Torvalds2012-01-141-1/+1
|\ \ \ \ | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | * 'for-linus' of git://selinuxproject.org/~jmorris/linux-security: capabilities: remove __cap_full_set definition security: remove the security_netlink_recv hook as it is equivalent to capable() ptrace: do not audit capability check when outputing /proc/pid/stat capabilities: remove task_ns_* functions capabitlies: ns_capable can use the cap helpers rather than lsm call capabilities: style only - move capable below ns_capable capabilites: introduce new has_ns_capabilities_noaudit capabilities: call has_ns_capability from has_capability capabilities: remove all _real_ interfaces capabilities: introduce security_capable_noaudit capabilities: reverse arguments to security_capable capabilities: remove the task from capable LSM hook entirely selinux: sparse fix: fix several warnings in the security server cod selinux: sparse fix: fix warnings in netlink code selinux: sparse fix: eliminate warnings for selinuxfs selinux: sparse fix: declare selinux_disable() in security.h selinux: sparse fix: move selinux_complete_init selinux: sparse fix: make selinux_secmark_refcount static SELinux: Fix RCU deref check warning in sel_netport_insert() Manually fix up a semantic mis-merge wrt security_netlink_recv(): - the interface was removed in commit fd7784615248 ("security: remove the security_netlink_recv hook as it is equivalent to capable()") - a new user of it appeared in commit a38f7907b926 ("crypto: Add userspace configuration API") causing no automatic merge conflict, but Eric Paris pointed out the issue.
| * | | | security: remove the security_netlink_recv hook as it is equivalent to capable()Eric Paris2012-01-051-1/+1
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Once upon a time netlink was not sync and we had to get the effective capabilities from the skb that was being received. Today we instead get the capabilities from the current task. This has rendered the entire purpose of the hook moot as it is now functionally equivalent to the capable() call. Signed-off-by: Eric Paris <eparis@redhat.com>
* | | | | block: fail SCSI passthrough ioctls on partition devicesPaolo Bonzini2012-01-141-2/+9
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Linux allows executing the SG_IO ioctl on a partition or LVM volume, and will pass the command to the underlying block device. This is well-known, but it is also a large security problem when (via Unix permissions, ACLs, SELinux or a combination thereof) a program or user needs to be granted access only to part of the disk. This patch lets partitions forward a small set of harmless ioctls; others are logged with printk so that we can see which ioctls are actually sent. In my tests only CDROM_GET_CAPABILITY actually occurred. Of course it was being sent to a (partition on a) hard disk, so it would have failed with ENOTTY and the patch isn't changing anything in practice. Still, I'm treating it specially to avoid spamming the logs. In principle, this restriction should include programs running with CAP_SYS_RAWIO. If for example I let a program access /dev/sda2 and /dev/sdb, it still should not be able to read/write outside the boundaries of /dev/sda2 independent of the capabilities. However, for now programs with CAP_SYS_RAWIO will still be allowed to send the ioctls. Their actions will still be logged. This patch does not affect the non-libata IDE driver. That driver however already tests for bd != bd->bd_contains before issuing some ioctl; it could be restricted further to forbid these ioctls even for programs running with CAP_SYS_ADMIN/CAP_SYS_RAWIO. Cc: linux-scsi@vger.kernel.org Cc: Jens Axboe <axboe@kernel.dk> Cc: James Bottomley <JBottomley@parallels.com> Signed-off-by: Paolo Bonzini <pbonzini@redhat.com> [ Make it also print the command name when warning - Linus ] Signed-off-by: Linus Torvalds <torvalds@linux-foundation.org>
* | | | | block: add and use scsi_blk_cmd_ioctlPaolo Bonzini2012-01-141-1/+1
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Introduce a wrapper around scsi_cmd_ioctl that takes a block device. The function will then be enhanced to detect partition block devices and, in that case, subject the ioctls to whitelisting. Cc: linux-scsi@vger.kernel.org Cc: Jens Axboe <axboe@kernel.dk> Cc: James Bottomley <JBottomley@parallels.com> Signed-off-by: Paolo Bonzini <pbonzini@redhat.com> Signed-off-by: Linus Torvalds <torvalds@linux-foundation.org>
* | | | | module_param: make bool parameters really bool (drivers & misc)Rusty Russell2012-01-134-5/+5
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | module_param(bool) used to counter-intuitively take an int. In fddd5201 (mid-2009) we allowed bool or int/unsigned int using a messy trick. It's time to remove the int/unsigned int option. For this version it'll simply give a warning, but it'll break next kernel version. Acked-by: Mauro Carvalho Chehab <mchehab@redhat.com> Signed-off-by: Rusty Russell <rusty@rustcorp.com.au>
* | | | | Merge branch 'linux-next' of ↵Linus Torvalds2012-01-112-7/+61
|\ \ \ \ \ | |_|_|/ / |/| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | git://git.kernel.org/pub/scm/linux/kernel/git/jbarnes/pci * 'linux-next' of git://git.kernel.org/pub/scm/linux/kernel/git/jbarnes/pci: (80 commits) x86/PCI: Expand the x86_msi_ops to have a restore MSIs. PCI: Increase resource array mask bit size in pcim_iomap_regions() PCI: DEVICE_COUNT_RESOURCE should be equal to PCI_NUM_RESOURCES PCI: pci_ids: add device ids for STA2X11 device (aka ConneXT) PNP: work around Dell 1536/1546 BIOS MMCONFIG bug that breaks USB x86/PCI: amd: factor out MMCONFIG discovery PCI: Enable ATS at the device state restore PCI: msi: fix imbalanced refcount of msi irq sysfs objects PCI: kconfig: English typo in pci/pcie/Kconfig PCI/PM/Runtime: make PCI traces quieter PCI: remove pci_create_bus() xtensa/PCI: convert to pci_scan_root_bus() for correct root bus resources x86/PCI: convert to pci_create_root_bus() and pci_scan_root_bus() x86/PCI: use pci_scan_bus() instead of pci_scan_bus_parented() x86/PCI: read Broadcom CNB20LE host bridge info before PCI scan sparc32, leon/PCI: convert to pci_scan_root_bus() for correct root bus resources sparc/PCI: convert to pci_create_root_bus() sh/PCI: convert to pci_scan_root_bus() for correct root bus resources powerpc/PCI: convert to pci_create_root_bus() powerpc/PCI: split PHB part out of pcibios_map_io_space() ... Fix up conflicts in drivers/pci/msi.c and include/linux/pci_regs.h due to the same patches being applied in other branches.
| * | | | PCI: Rework config space blocking servicesJan Kiszka2012-01-062-7/+61
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | pci_block_user_cfg_access was designed for the use case that a single context, the IPR driver, temporarily delays user space accesses to the config space via sysfs. This assumption became invalid by the time pci_dev_reset was added as locking instance. Today, if you run two loops in parallel that reset the same device via sysfs, you end up with a kernel BUG as pci_block_user_cfg_access detect the broken assumption. This reworks the pci_block_user_cfg_access to a sleeping service pci_cfg_access_lock and an atomic-compatible variant called pci_cfg_access_trylock. The former not only blocks user space access as before but also waits if access was already locked. The latter service just returns false in this case, allowing the caller to resolve the conflict instead of raising a BUG. Adaptions of the ipr driver were originally written by Brian King. Acked-by: Brian King <brking@linux.vnet.ibm.com> Acked-by: Michael S. Tsirkin <mst@redhat.com> Signed-off-by: Jan Kiszka <jan.kiszka@siemens.com> Signed-off-by: Jesse Barnes <jbarnes@virtuousgeek.org>
* | | | | Merge tag 'scsi-misc' of ↵Linus Torvalds2012-01-1064-2597/+3610
|\ \ \ \ \ | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | git://git.kernel.org/pub/scm/linux/kernel/git/jejb/scsi-misc-2.6 SCSI updates for post 3.2 merge window * tag 'scsi-misc' of git://git.kernel.org/pub/scm/linux/kernel/git/jejb/scsi-misc-2.6: (67 commits) [SCSI] lpfc 8.3.28: Update driver version to 8.3.28 [SCSI] lpfc 8.3.28: Add Loopback support for SLI4 adapters [SCSI] lpfc 8.3.28: Critical Miscellaneous fixes [SCSI] Lpfc 8.3.28: FC and SCSI Discovery Fixes [SCSI] lpfc 8.3.28: Add support for ABTS failure handling [SCSI] lpfc 8.3.28: SLI fixes and added SLI4 support [SCSI] lpfc 8.3.28: Miscellaneous fixes in sysfs and mgmt interfaces [SCSI] mpt2sas: Removed redundant calling of _scsih_probe_devices() from _scsih_probe [SCSI] mac_scsi: Remove obsolete IRQ_FLG_* users [SCSI] qla4xxx: Update driver version to 5.02.00-k10 [SCSI] qla4xxx: check for FW alive before calling chip_reset [SCSI] qla4xxx: Fix qla4xxx_dump_buffer to dump buffer correctly [SCSI] qla4xxx: Fix the IDC locking mechanism [SCSI] qla4xxx: Wait for disable_acb before doing set_acb [SCSI] qla4xxx: Don't recover adapter if device state is FAILED [SCSI] qla4xxx: fix call trace on rmmod with ql4xdontresethba=1 [SCSI] qla4xxx: Fix CPU lockups when ql4xdontresethba set [SCSI] qla4xxx: Perform context resets in case of context failures. [SCSI] iscsi class: export pid of process that created [SCSI] mpt2sas: Remove unused duplicate diag_buffer_enable param ...
| * | | | | [SCSI] lpfc 8.3.28: Update driver version to 8.3.28James Smart2011-12-151-1/+1
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Signed-off-by: Alex Iannicelli <alex.iannicelli@emulex.com> Signed-off-by: James Smart <james.smart@emulex.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] lpfc 8.3.28: Add Loopback support for SLI4 adaptersJames Smart2011-12-159-167/+470
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | - Add Basic support for SLI4 Loopback. (CR 124951, 125766, 124951, 125843, 125832, 125843) - Added missing protection in setting/clearing of phba->link_flag bit field (CR 125994) - Use link type and link number obtained from READ_CONFIG mailbox command. (CR 126264) Signed-off-by: Alex Iannicelli <alex.iannicelli@emulex.com> Signed-off-by: James Smart <james.smart@emulex.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] lpfc 8.3.28: Critical Miscellaneous fixesJames Smart2011-12-156-139/+350
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | - Make lpfc_sli4_pci_mem_unset interface type aware (CR 124390) - Convert byte count to word count when calling __iowrite32_copy (CR 122550) - Checked the ERR1 and ERR2 registers for error attention due to SLI Port state affected by forced debug dump. (CR 122986, 122426, 124859) - Use the lpfc_readl routine instead of the readl for the port status register read in lpfc_handle_eratt_s4 (CR 125403) - Call lpfc_sli4_queue_destroy inside of lpfc_sli4_brdreset before doing a pci function reset (CR 125124, 125168, 125572, 125622) - Zero out the HBQ when it is allocated (CR 125663) - Alter port reset log messages to indicate error type (CR 125989) - Added proper NULL pointer checking to all the places that accessing the queue memory (CR 125832) Signed-off-by: Alex Iannicelli <alex.iannicelli@emulex.com> Signed-off-by: James Smart <james.smart@emulex.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] Lpfc 8.3.28: FC and SCSI Discovery FixesJames Smart2011-12-158-19/+75
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | FC and SCSI Discovery Fixes: - Clear the virtual fabrics bit (word 1 bit 30) when sending the FLOGI and FDISC. (CR 124339) - Return a MLQUEUE_DEVICE_BUSY if the driver detects that an I/O is being retried too quickly (CR 124668) - Remove NDLP reference put in lpfc_cmpl_els_logo_acc for all but fabric nodes (CR 123924) - Only retry FDISCs every second and stop retrying after devloss number of retries (CR 13939) - Check to see if vports are unloading before adding them to the vport work array. (CR 124996) - Fixed illegal state transition during driver unload (CR 124191) - Added missing protection on setting/clearing of vport->fc_flag bit (CR 126002) - Set NPIV flag in lpfc_mbx_process_link_up for all ports sli3 and above. (CR 126094) - Clear FCP command bytes that are not used. (CR 126209) Signed-off-by: Alex Iannicelli <alex.iannicelli@emulex.com> Signed-off-by: James Smart <james.smart@emulex.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] lpfc 8.3.28: Add support for ABTS failure handlingJames Smart2011-12-157-93/+263
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Add support for ABTS failure handling: - Add asynchronous ABTS notification event feature to driver (CR 124578) - Change driver message 3092 and 3116 to KERN_WARNING (CR 124768) - Alter the SCR ELS command to use the temporary RPI and the Destination DID for SLI4-FC (CR 126070) Signed-off-by: Alex Iannicelli <alex.iannicelli@emulex.com> Signed-off-by: James Smart <james.smart@emulex.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] lpfc 8.3.28: SLI fixes and added SLI4 supportJames Smart2011-12-157-126/+156
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Adapter (SLI) interface fixes: - Modify WQ handling to use entry_repost (CR 123981) - Fix for ABTS. Do not free original IOCB whenever ABTS fails. (CR 115829) - Check board for FCoE before reading FCoE paramaters (CR124731) - Add support for SLI4 FC Loop mode (CR 124721) - Add support for resource count changes during fw reset. (CR 125888, 125675) - Increase CQE count from 256 to 1024. (CR 126149) Signed-off-by: Alex Iannicelli <alex.iannicelli@emulex.com> Signed-off-by: James Smart <james.smart@emulex.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] lpfc 8.3.28: Miscellaneous fixes in sysfs and mgmt interfacesJames Smart2011-12-159-398/+356
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Miscellaneous fixes in sysfs and mgmt interfaces: - Added SLI4 INTF_TYPE and SLI_FAMILY as sub-field to the fwrev sysfs attribute (CR 124103) - Added a sysfs attribute "protocol" to report SLI4 port link protocol type (CR 124102) - Increment mix-and-match minor number by 1 for added "protocol" sysfs attribute. (124102) - Move the link speed check into the generic sli3/sli4 code path. (CR 124185, 124122) - Deleted check for inExtWLen (CR 122523) - Add the word "offline" to message 2889 (CR 124385) - Conditionalize the firmware upgrade/downgrade so that it is only attempted for SLI4 type 2 boards (CR 124406) - Return an error if the mbox sysfs is called. (CR 124210) - When port_state is less than LPFC_VPORT_READY, report FC_PORTSTATE_BYPASSED (CR 120018) - Added driver support for performing persistent linkdown based on configure region 23 (CR 124534) - Added restore state and error log when sysfs board_mode attribute access failed (CR 124158) - Added support for SLI4_CONFIG non-embedded COMN_GET_CNTL_ADDL_ATTR pass-through (CR 124466) - Rejecting un-supported multi-buffer mailbox commands (CR 124771) - Byte swap the extended data request and response data for extended mailbox data (CR 125081) Signed-off-by: Alex Iannicelli <alex.iannicelli@emulex.com> Signed-off-by: James Smart <james.smart@emulex.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Removed redundant calling of _scsih_probe_devices() from ↵nagalakshmi.nandigama@lsi.com2011-12-152-15/+8
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | _scsih_probe Removed redundant calling of _scsih_probe_devices() from _scsih_probe as it is getting called from _scsih_scan_finished. Also moved the function scsi_scan_host(shost) to get called after the volumes on warp drive are reported to the OS. Otherwise by the time the (ioc->hide_drives) flags is set, the volumes on warp drive are reported to the OS already. Also modified the initialization of reply queues only in case of driver load time in the function _base_make_ioc_operational(). Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mac_scsi: Remove obsolete IRQ_FLG_* usersGeert Uytterhoeven2011-12-151-2/+1
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | The m68k core irq code stopped honoring these flags during the irq restructuring in 2006. Signed-off-by: Geert Uytterhoeven <geert@linux-m68k.org> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: Update driver version to 5.02.00-k10Vikas Chaudhary2011-12-151-1/+1
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: check for FW alive before calling chip_resetShyam Sunder2011-12-152-24/+52
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Check for firmware alive and do premature completion of mbox commands in case of FW hung before doing chip_reset Signed-off-by: Shyam Sunder <shyam.sunder@qlogic.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: Nilesh Javali <nilesh.javali@qlogic.com> Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: Fix qla4xxx_dump_buffer to dump buffer correctlyVikas Chaudhary2011-12-151-3/+3
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | KERN_INFO in printk adding new line character that mess-up dump print format. Remove KERN_INFO to fix dump format. Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: Fix the IDC locking mechanismNilesh Javali2011-12-151-8/+11
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | This ensures the transition of dev_state from COLD to INITIALIZING is within lock and atomic. Signed-off-by: Nilesh Javali <nilesh.javali@qlogic.com> Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: Wait for disable_acb before doing set_acbVikas Chaudhary2011-12-151-1/+10
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | In function qla4xxx_iface_set_param wait for disable_acb to complete so that set_acb will not fail. Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: Don't recover adapter if device state is FAILEDSarang Radke2011-12-151-0/+21
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Multiple reset request don't get handled correctly as the driver tries to recover adapter which is in FAILED state. Signed-off-by: Sarang Radke <sarang.radke@qlogic.com> Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: fix call trace on rmmod with ql4xdontresethba=1Sarang Radke2011-12-151-0/+20
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | abort all active commands from eh_host_reset in-case of ql4xdontresethba=1 Fix following call trace:- Nov 21 14:50:47 172.17.140.111 qla4xxx 0000:13:00.4: qla4_8xxx_disable_msix: qla4xxx (rsp_q) Nov 21 14:50:47 172.17.140.111 qla4xxx 0000:13:00.4: PCI INT A disabled Nov 21 14:50:47 172.17.140.111 slab error in kmem_cache_destroy(): cache `qla4xxx_srbs': Can't free all objects Nov 21 14:50:47 172.17.140.111 Pid: 9154, comm: rmmod Tainted: G O 3.2.0-rc2+ #2 Nov 21 14:50:47 172.17.140.111 Call Trace: Nov 21 14:50:47 172.17.140.111 [<c051231a>] ? kmem_cache_destroy+0x9a/0xb0 Nov 21 14:50:47 172.17.140.111 [<c0489c4a>] ? sys_delete_module+0x14a/0x210 Nov 21 14:50:47 172.17.140.111 [<c04fd552>] ? do_munmap+0x202/0x280 Nov 21 14:50:47 172.17.140.111 [<c04a6d4e>] ? audit_syscall_entry+0x1ae/0x1d0 Nov 21 14:50:47 172.17.140.111 [<c083019f>] ? sysenter_do_call+0x12/0x28 Nov 21 14:51:50 172.17.140.111 SLAB: cache with size 64 has lost its name Nov 21 14:51:50 172.17.140.111 iscsi: registered transport (qla4xxx) Nov 21 14:51:50 172.17.140.111 qla4xxx 0000:13:00.4: PCI INT A -> GSI 28 (level, low) -> IRQ 28 Signed-off-by: Sarang Radke <sarang.radke@qlogic.com> Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: Fix CPU lockups when ql4xdontresethba setMike Hernandez2011-12-151-0/+4
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Fix issue where CPU lockup is seen when ql4xdontresethba is set and driver is "stuck" in NEED_RESET state handler. Signed-off-by: Mike Hernandez <michael.hernandez@qlogic.com> Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] qla4xxx: Perform context resets in case of context failures.Vikas Chaudhary2011-12-151-11/+19
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | For 4032, context reset was the same as chip reset, and any firmware issue was recovered by performing a chip reset. For 82xx, the iSCSI firmware runs along with FCoE and the NIC firmware contexts, and an error encountered doesnot essentially mean that a chip reset is necessary. Perform Chip resets only in the following cases: 1. Mailbox system error. 2. Mailbox command timeout. 3. fw_heartbeat_counter counter stops incrementing. For all other cases, only perform a context reset. 1. Command Completion with an invalid srb. 2. Other mailbox failures. Signed-off-by: Vikas Chaudhary <vikas.chaudhary@qlogic.com> Signed-off-by: Shyam Sunder <shyam.sunder@qlogic.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] iscsi class: export pid of process that createdMike Christie2011-12-151-2/+19
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | There could be multiple userspace entities creating/destroying/ recoverying sessions and also the kernel's iscsi drivers could be doing this too. If the userspace apps do try to manage the kernel ones it can get the driver/fw out of sync and cause the user to loose the root disk, oopses or ping ponging becasue userspace wants to do one thing but the kernel manager thought we are trying to do another. This patch fixes the problem by just exporting the pid of the entity that created the session. Userspace programs like iscsid, iscsiadm, iscsistart, qlogic's tools, etc, can then figure out which sessions they own and only manage them. Signed-off-by: Mike Christie <michaelc@cs.wisc.edu> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Remove unused duplicate diag_buffer_enable paramRoland Dreier2011-12-151-13/+0
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Commit 921cd8024b90 ("[SCSI] mpt2sas: New feature - Fast Load Support") moved handling of the diag_buffer_enable module parameter from mpt2sas_base.c to mpt2sas_scsih.c, but it left an old copy of the parameter in mpt2sas_base.c. Remove the unused stub. Signed-off-by: Roland Dreier <roland@purestorage.com> Acked-by: "Nandigama, Nagalakshmi" <Nagalakshmi.Nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Fix possible integer truncation of cpu_countRoland Dreier2011-12-151-1/+1
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | When computing reply_queue_count (the number of MSI-X vectors to use), the driver does ioc->reply_queue_count = min_t(u8, ioc->cpu_count, ioc->msix_vector_count); However, on a big machine, ioc->cpu_count could be outside the range that fits in a u8; eg a system with 256 CPUs will end up reply_queue_count set to 0. Fix this by calculating the minimum as ints and then letting the assignment to reply_queue_count handle integer demotion. Signed-off-by: Roland Dreier <roland@purestorage.com> Acked-by: "Nandigama, Nagalakshmi" <Nagalakshmi.Nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Fix leak on mpt2sas_base_attach() error pathRoland Dreier2011-12-151-1/+1
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Commit 911ae9434f83 ("[SCSI] mpt2sas: Added NUNA IO support in driver which uses multi-reply queue support of the HBA") added new allocations to the beginning of mpt2sas_base_attach(), which means directly returning an error on failure of mpt2sas_base_map_resources() will leak those allocations. Fix this by doing "goto out_free_resources" in this place too, as the rest of the function does. Signed-off-by: Roland Dreier <roland@purestorage.com> Acked-by: "Nandigama, Nagalakshmi" <Nagalakshmi.Nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas : Bump driver vesion to 12.100.00.00nagalakshmi.nandigama@lsi.com2011-12-151-2/+2
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Bump driver vesion to 12.100.00.00 Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas : Fix for memory allocation error for large host creditsnagalakshmi.nandigama@lsi.com2011-12-152-58/+29
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | The amount of memory required for tracking chain buffers is rather large, and when the host credit count is big, memory allocation failure occurs inside __get_free_pages. The fix is to limit the number of chains to 100,000. In addition, the number of host credits is limited to 30,000 IOs. However this limitation can be overridden this using the command line option max_queue_depth. The algorithm for calculating the reply_post_queue_depth is changed so that it is equal to (reply_free_queue_depth + 16), previously it was (reply_free_queue_depth * 2). Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Cc: stable@kernel.org Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Do not retry a timed out direct IO for warpdrivenagalakshmi.nandigama@lsi.com2011-12-151-2/+4
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | When an I/O request to a WarpDrive is timed out by SML and if the I/O request to the WarpDrive is sent as direct I/O then the aborted direct I/O will be retried as normal Volume I/O and which results in failure of Target Reset and results in host reset. The fix is to not retry a failed IO to volume when the original IO was sent as direct IO with an ioc status MPI2_IOCSTATUS_SCSI_TASK_TERMINATED. Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Release spinlock for the raid device list before blocking itnagalakshmi.nandigama@lsi.com2011-12-151-3/+4
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Added code to release the spinlock that is used to protect the raid device list before calling a function that can block. The blocking was causing a reschedule, and subsequently it is tried to acquire the same lock, resulting in a panic (NMI Watchdog detecting a CPU lockup). Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Cc: stable@kernel.org Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: MPI next revision header updatenagalakshmi.nandigama@lsi.com2011-12-154-23/+90
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | 1)Removed Power Management Control option for PCIe link. 2)Added RAID Action for performing a compatibility check. Added product-specific range to RAID Action values. 3)Added PhysicalPort field to SAS Device Status Change Event data. 4)Added SpinupFlags field containing a Disable Spin-up bit to the SpinupGroupParameters fields of SAS IO Unit Page 4. Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Added support for customer specific brandingnagalakshmi.nandigama@lsi.com2011-12-152-0/+28
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Increase max transfer support from 4MB to 16MBnagalakshmi.nandigama@lsi.com2011-12-151-5/+5
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Increase max transfer support from 4MB to 16MB. This is done by changing the shost->max_sector from 8192 to 32767 Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Support for greater than 2TB capacity WarpDrivenagalakshmi.nandigama@lsi.com2011-12-152-43/+74
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | The driver is modified to allow access to the greater than 2TB WarpDrive and properly handle direct-io mapping for WarpDrive volumes greater than 2TB. Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Bump driver version to 11.100.00.00nagalakshmi.nandigama@lsi.com2011-12-151-2/+2
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Rearrange the the code so that the completion queues are ↵nagalakshmi.nandigama@lsi.com2011-12-153-11/+12
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | initialized prior to sending the request to controller firmware Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Do not set sas_device->starget to NULL from the ↵nagalakshmi.nandigama@lsi.com2011-12-151-8/+12
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | slave_destroy callback when all the LUNS have been deleted If the sas_device->starget to NULL from slave_destroy callback for LUN=1 even though LUN=0 exist, results in entire target getting deleted. To resolve the issue, the driver should only set sas_device->starget to NULL when all the LUNS have been deleted from the slave_destroy. Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: MPI next revision header updatenagalakshmi.nandigama@lsi.com2011-12-154-22/+36
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | 1) Added product specific range of ImageType macros for the Extended Image Header. 2) Added Flags field and related defines to MPI2_TOOLBOX_ISTWI_READ_WRITE_REQUEST to support automatic reserve/release and page addressing. Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Adding support for customer specific brandingnagalakshmi.nandigama@lsi.com2011-12-152-2/+7
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: When IOs are terminated, update the result to DID_SOFT_ERROR ↵nagalakshmi.nandigama@lsi.com2011-12-151-0/+2
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | to avoid infinite resets Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] mpt2sas: Better handling DEAD IOC (PCI-E LInk down) error conditionnagalakshmi.nandigama@lsi.com2011-12-153-0/+63
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | Detection of Dead IOC has been done in fault_reset_work thread. If IOC Doorbell is 0xFFFFFFFF, it will be detected as non-operation/DEAD IOC. When a DEAD IOC is detected, the code is modified to remove that IOC and all its attached devices from OS. The PCI layer API pci_remove_bus_device() is called to remove the dead IOC. Signed-off-by: Nagalakshmi Nandigama <nagalakshmi.nandigama@lsi.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] be2iscsi: cleanup a min_t() callDan Carpenter2011-12-151-2/+3
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | "sense_len" was declared as int type but actually it only stores a u16 value that comes from hardware. The cast to u16 in min_t() confuses static analysis because it truncates the int to u16 so I've fixed the declaration to reflect that "sense_len" is just a u16. Also there was a call to cpu_to_be16() which I've changed to be16_to_cpu(). The functions are equivalent, but obviously the hardware is big endian and we're doing the min_t() comparison on CPU endian values. This whole patch is just a cleanup and doesn't affect how the code works. Signed-off-by: Dan Carpenter <dan.carpenter@oracle.com> Reviewed-by: Mike Christie <michaelc@cs.wisc.edu> Acked-by: Jayamohan Kallickal <Jayamohan.kallickal@emulex.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>
| * | | | | [SCSI] hpsa: add the Smart Array 5i to the kdump blacklistTomas Henzl2011-12-151-0/+2
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | The '5i' controller freezes when a kdump is attemted. This patch admits it and adds the controller to the unresetable list. Signed-off-by: Tomas Henzl <thenzl@redhat.com> Signed-off-by: James Bottomley <JBottomley@Parallels.com>